Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (60 species) not a true protein |
Species Staphylococcus saprophyticus [TaxId:342451] [225319] (2 PDB entries) |
Domain d3e61b_: 3e61 B: [245799] automated match to d2rgya_ complexed with gol |
PDB Entry: 3e61 (more details), 2 Å
SCOPe Domain Sequences for d3e61b_:
Sequence, based on SEQRES records: (download)
>d3e61b_ c.93.1.0 (B:) automated matches {Staphylococcus saprophyticus [TaxId: 342451]} liglllpdmsnpfftliargvedvalahgyqvlignsdndikkaqgylatfvshnctgmi stafneniientltdhhipfvfidrinnehngistnhfkggqlqaevvrkgkgknvlivh enllidafhqrvqgikyildqqridykmleatlldndkkfidlikelsidsiicsndlla invlgivqryhfkvpaeiqiigydnipfsemtypqittidqsayhlgeiavsqllglntd nltnnhkqlaltvkhrgstr
>d3e61b_ c.93.1.0 (B:) automated matches {Staphylococcus saprophyticus [TaxId: 342451]} liglllpdmsnpfftliargvedvalahgyqvlignsdndikkaqgylatfvshnctgmi stafneniientltdhhipfvfidngistnhfkggqlqaevvrkgkgknvlivhenllid afhqrvqgikyildqqridykmleatlldndkkfidlikelsidsiicsndllainvlgi vqryhfkvpaeiqiigydnipfsemtypqittidqsayhlgeiavsqllgaltvkhrgst r
Timeline for d3e61b_: