![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
![]() | Protein automated matches [190646] (76 species) not a true protein |
![]() | Species Staphylococcus saprophyticus [TaxId:342451] [225319] (2 PDB entries) |
![]() | Domain d3e61a1: 3e61 A:61-320 [245798] Other proteins in same PDB: d3e61a2 automated match to d2rgya_ complexed with gol |
PDB Entry: 3e61 (more details), 2 Å
SCOPe Domain Sequences for d3e61a1:
Sequence, based on SEQRES records: (download)
>d3e61a1 c.93.1.0 (A:61-320) automated matches {Staphylococcus saprophyticus [TaxId: 342451]} liglllpdmsnpfftliargvedvalahgyqvlignsdndikkaqgylatfvshnctgmi stafneniientltdhhipfvfidrinnehngistnhfkggqlqaevvrkgkgknvlivh enllidafhqrvqgikyildqqridykmleatlldndkkfidlikelsidsiicsndlla invlgivqryhfkvpaeiqiigydnipfsemtypqittidqsayhlgeiavsqllglntd nltnnhkqlaltvkhrgstr
>d3e61a1 c.93.1.0 (A:61-320) automated matches {Staphylococcus saprophyticus [TaxId: 342451]} liglllpdmsnpfftliargvedvalahgyqvlignsdndikkaqgylatfvshnctgmi stafneniientltdhipfvfidrinhfkggqlqaevvrkgkgknvlivhenllidafhq rvqgikyildqdykmleatlldndkkfidlikelsidsiicsndllainvlgivqryhfk vpaeiqiigydnipfsemtypqittidqsayhlgeiavsqllaltvkhrgstr
Timeline for d3e61a1: