Lineage for d3e61a1 (3e61 A:61-320)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144253Species Staphylococcus saprophyticus [TaxId:342451] [225319] (2 PDB entries)
  8. 2144254Domain d3e61a1: 3e61 A:61-320 [245798]
    Other proteins in same PDB: d3e61a2
    automated match to d2rgya_
    complexed with gol

Details for d3e61a1

PDB Entry: 3e61 (more details), 2 Å

PDB Description: crystal structure of a putative transcriptional repressor of ribose operon from staphylococcus saprophyticus subsp. saprophyticus
PDB Compounds: (A:) Putative transcriptional repressor of ribose operon

SCOPe Domain Sequences for d3e61a1:

Sequence, based on SEQRES records: (download)

>d3e61a1 c.93.1.0 (A:61-320) automated matches {Staphylococcus saprophyticus [TaxId: 342451]}
liglllpdmsnpfftliargvedvalahgyqvlignsdndikkaqgylatfvshnctgmi
stafneniientltdhhipfvfidrinnehngistnhfkggqlqaevvrkgkgknvlivh
enllidafhqrvqgikyildqqridykmleatlldndkkfidlikelsidsiicsndlla
invlgivqryhfkvpaeiqiigydnipfsemtypqittidqsayhlgeiavsqllglntd
nltnnhkqlaltvkhrgstr

Sequence, based on observed residues (ATOM records): (download)

>d3e61a1 c.93.1.0 (A:61-320) automated matches {Staphylococcus saprophyticus [TaxId: 342451]}
liglllpdmsnpfftliargvedvalahgyqvlignsdndikkaqgylatfvshnctgmi
stafneniientltdhipfvfidrinhfkggqlqaevvrkgkgknvlivhenllidafhq
rvqgikyildqdykmleatlldndkkfidlikelsidsiicsndllainvlgivqryhfk
vpaeiqiigydnipfsemtypqittidqsayhlgeiavsqllaltvkhrgstr

SCOPe Domain Coordinates for d3e61a1:

Click to download the PDB-style file with coordinates for d3e61a1.
(The format of our PDB-style files is described here.)

Timeline for d3e61a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3e61a2
View in 3D
Domains from other chains:
(mouse over for more information)
d3e61b_