SCOPe 2.07: Domain d3e3ab1: 3e3a B:-5-261

Lineage for d3e3ab1 (3e3a B:-5-261)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (124 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [232505] (4 PDB entries)

8. Domain d3e3ab1: 3e3a B:-5-261 [245792]
   Other proteins in same PDB: d3e3aa2, d3e3ab2
   automated match to d3hssb_
   complexed with act, mpd

Details for d3e3ab1

PDB Entry: 3e3a, 2.35 Å

PDB Description: the structure of rv0554 from mycobacterium tuberculosis

PDB Compounds: (B:) possible peroxidase bpoc

SCOPe Domain Sequences for d3e3ab1:

Sequence; same for both SEQRES and ATOM records:

>d3e3ab1 c.69.1.0 (B:-5-261) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mdpefrvinlayddngtgdpvvfiagrggagrtwhphqvpaflaagyrcitfdnrgigat
enaegfttqtmvadtaalietldiaparvvgvsmgafiaqelmvvapelvssavlmatrg
rldrarqffnkaeaelydsgvqlpptydararllenfsrktlnddvavgdwiamfsmwpi
kstpglrcqldcapqtnrlpayrniaapvlvigfaddvvtppylgrevadalpngrylqi
pdaghlgfferpeavntamlkffasvk

Timeline for d3e3ab1:

• d3e3ab1 first appeared in SCOPe 2.04, called d3e3ab_
  
• d3e3ab1 appears in SCOPe 2.06
  
• d3e3ab1 appears in the current release, SCOPe 2.08