Lineage for d3e3ab1 (3e3a B:-5-261)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2153143Species Mycobacterium tuberculosis [TaxId:1773] [232505] (4 PDB entries)
  8. 2153145Domain d3e3ab1: 3e3a B:-5-261 [245792]
    Other proteins in same PDB: d3e3aa2, d3e3ab2
    automated match to d3hssb_
    complexed with act, mpd

Details for d3e3ab1

PDB Entry: 3e3a (more details), 2.35 Å

PDB Description: the structure of rv0554 from mycobacterium tuberculosis
PDB Compounds: (B:) possible peroxidase bpoc

SCOPe Domain Sequences for d3e3ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e3ab1 c.69.1.0 (B:-5-261) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mdpefrvinlayddngtgdpvvfiagrggagrtwhphqvpaflaagyrcitfdnrgigat
enaegfttqtmvadtaalietldiaparvvgvsmgafiaqelmvvapelvssavlmatrg
rldrarqffnkaeaelydsgvqlpptydararllenfsrktlnddvavgdwiamfsmwpi
kstpglrcqldcapqtnrlpayrniaapvlvigfaddvvtppylgrevadalpngrylqi
pdaghlgfferpeavntamlkffasvk

SCOPe Domain Coordinates for d3e3ab1:

Click to download the PDB-style file with coordinates for d3e3ab1.
(The format of our PDB-style files is described here.)

Timeline for d3e3ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3e3ab2