Lineage for d1mmga1 (1mmg A:34-79)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946622Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 946623Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 946624Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 946658Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (21 PDB entries)
  8. 946671Domain d1mmga1: 1mmg A:34-79 [24579]
    Other proteins in same PDB: d1mmga2
    complexed with ags, mg

Details for d1mmga1

PDB Entry: 1mmg (more details), 2.1 Å

PDB Description: x-ray structures of the mgadp, mgatpgammas, and mgamppnp complexes of the dictyostelium discoideum myosin motor domain
PDB Compounds: (A:) myosin

SCOPe Domain Sequences for d1mmga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmga1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
yiwynpdpkerdsyecgeivsetsdsftfktsdgqdrqvkkddanq

SCOPe Domain Coordinates for d1mmga1:

Click to download the PDB-style file with coordinates for d1mmga1.
(The format of our PDB-style files is described here.)

Timeline for d1mmga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mmga2