| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
| Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
| Protein automated matches [226938] (26 species) not a true protein |
| Species Methanocaldococcus jannaschii [TaxId:2190] [255807] (1 PDB entry) |
| Domain d3e2pl1: 3e2p L:1-147 [245785] automated match to d2be7a1 complexed with so4 |
PDB Entry: 3e2p (more details), 3 Å
SCOPe Domain Sequences for d3e2pl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e2pl1 c.78.1.0 (L:1-147) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mkhlismkdigkeeileildearkmeellntkrplkllegkilatvfyepstrtrlsfet
amkrlggevitmtdlksssvakgeslidtirvisgyadiivlrhpsegaarlaseysqvp
iinagdgsnqhptqtlldlytimreig
Timeline for d3e2pl1: