![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
![]() | Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
![]() | Protein automated matches [226938] (26 species) not a true protein |
![]() | Species Methanocaldococcus jannaschii [TaxId:2190] [255807] (1 PDB entry) |
![]() | Domain d3e2pk2: 3e2p K:148-305 [245784] automated match to d2be7a2 complexed with so4 |
PDB Entry: 3e2p (more details), 3 Å
SCOPe Domain Sequences for d3e2pk2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e2pk2 c.78.1.0 (K:148-305) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]} ridgikiafvgdlkygrtvhslvyalslfenvemyfvspkelrlpkdiiedlkaknikfy ekeslddldddidvlyvtriqkerfpdpneyekvkgsykikreyvegkkfiimhplprvd eidydvddlpqakyfkqsfygipvrmailkkliedneg
Timeline for d3e2pk2: