Lineage for d3e2pf2 (3e2p F:148-306)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2906980Species Methanocaldococcus jannaschii [TaxId:2190] [255807] (1 PDB entry)
  8. 2906992Domain d3e2pf2: 3e2p F:148-306 [245778]
    automated match to d2be7a2
    complexed with so4

Details for d3e2pf2

PDB Entry: 3e2p (more details), 3 Å

PDB Description: Catalytic subunit of M. Jannaschii aspartate transcarbamoylase in an orthorhombic crystal form
PDB Compounds: (F:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d3e2pf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e2pf2 c.78.1.0 (F:148-306) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
ridgikiafvgdlkygrtvhslvyalslfenvemyfvspkelrlpkdiiedlkaknikfy
ekeslddldddidvlyvtriqkerfpdpneyekvkgsykikreyvegkkfiimhplprvd
eidydvddlpqakyfkqsfygipvrmailkkliednege

SCOPe Domain Coordinates for d3e2pf2:

Click to download the PDB-style file with coordinates for d3e2pf2.
(The format of our PDB-style files is described here.)

Timeline for d3e2pf2: