Lineage for d3e2pe1 (3e2p E:1-147)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2906980Species Methanocaldococcus jannaschii [TaxId:2190] [255807] (1 PDB entry)
  8. 2906989Domain d3e2pe1: 3e2p E:1-147 [245775]
    automated match to d2be7a1
    complexed with so4

Details for d3e2pe1

PDB Entry: 3e2p (more details), 3 Å

PDB Description: Catalytic subunit of M. Jannaschii aspartate transcarbamoylase in an orthorhombic crystal form
PDB Compounds: (E:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d3e2pe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e2pe1 c.78.1.0 (E:1-147) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mkhlismkdigkeeileildearkmeellntkrplkllegkilatvfyepstrtrlsfet
amkrlggevitmtdlksssvakgeslidtirvisgyadiivlrhpsegaarlaseysqvp
iinagdgsnqhptqtlldlytimreig

SCOPe Domain Coordinates for d3e2pe1:

Click to download the PDB-style file with coordinates for d3e2pe1.
(The format of our PDB-style files is described here.)

Timeline for d3e2pe1: