SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3e2pa1 (3e2p A:1-147)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139045Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2139046Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2139496Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2139497Protein automated matches [226938] (22 species)
    not a true protein
  7. 2139589Species Methanocaldococcus jannaschii [TaxId:2190] [255807] (1 PDB entry)
  8. 2139590Domain d3e2pa1: 3e2p A:1-147 [245767]
    automated match to d2be7a1
    complexed with so4

Details for d3e2pa1

PDB Entry: 3e2p (more details), 3 Å

PDB Description: Catalytic subunit of M. Jannaschii aspartate transcarbamoylase in an orthorhombic crystal form
PDB Compounds: (A:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d3e2pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e2pa1 c.78.1.0 (A:1-147) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mkhlismkdigkeeileildearkmeellntkrplkllegkilatvfyepstrtrlsfet
amkrlggevitmtdlksssvakgeslidtirvisgyadiivlrhpsegaarlaseysqvp
iinagdgsnqhptqtlldlytimreig

SCOPe Domain Coordinates for d3e2pa1:

Click to download the PDB-style file with coordinates for d3e2pa1.
(The format of our PDB-style files is described here.)

Timeline for d3e2pa1: