Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (125 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries) |
Domain d3e1f43: 3e1f 4:334-625 [245763] Other proteins in same PDB: d3e1f11, d3e1f12, d3e1f14, d3e1f15, d3e1f21, d3e1f22, d3e1f24, d3e1f25, d3e1f31, d3e1f32, d3e1f34, d3e1f35, d3e1f41, d3e1f42, d3e1f44, d3e1f45 automated match to d1jz7a5 complexed with dms, gal, mg, na |
PDB Entry: 3e1f (more details), 3 Å
SCOPe Domain Sequences for d3e1f43:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e1f43 c.1.8.0 (4:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeanietegmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d3e1f43:
View in 3D Domains from same chain: (mouse over for more information) d3e1f41, d3e1f42, d3e1f44, d3e1f45 |