SCOPe 2.07: Domain d3e1f43: 3e1f 4:334-625

Lineage for d3e1f43 (3e1f 4:334-625)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (125 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries)

8. Domain d3e1f43: 3e1f 4:334-625 [245763]
   Other proteins in same PDB: d3e1f11, d3e1f12, d3e1f14, d3e1f15, d3e1f21, d3e1f22, d3e1f24, d3e1f25, d3e1f31, d3e1f32, d3e1f34, d3e1f35, d3e1f41, d3e1f42, d3e1f44, d3e1f45
   automated match to d1jz7a5
   complexed with dms, gal, mg, na

Details for d3e1f43

PDB Entry: 3e1f, 3 Å

PDB Description: e.coli (lacz) beta-galactosidase (h418e) in complex with galactose

PDB Compounds: (4:) beta-galactosidase

SCOPe Domain Sequences for d3e1f43:

Sequence; same for both SEQRES and ATOM records:

>d3e1f43 c.1.8.0 (4:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeanietegmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

Timeline for d3e1f43:

• d3e1f43 first appeared in SCOPe 2.04
  
• d3e1f43 appears in SCOPe 2.06
  
• d3e1f43 appears in the current release, SCOPe 2.08