Lineage for d1lvk_1 (1lvk 34-79)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109314Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 109530Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 109531Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 109532Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)
  7. 109554Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (18 PDB entries)
  8. 109555Domain d1lvk_1: 1lvk 34-79 [24576]
    Other proteins in same PDB: d1lvk_2

Details for d1lvk_1

PDB Entry: 1lvk (more details), 1.9 Å

PDB Description: x-ray crystal structure of the mg (dot) 2'(3')-o-(n-methylanthraniloyl) nucleotide bound to dictyostelium discoideum myosin motor domain

SCOP Domain Sequences for d1lvk_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvk_1 b.34.3.1 (34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)}
yiwynpdpkerdsyecgeivsetsdsftfktsdgqdrqvkkddanq

SCOP Domain Coordinates for d1lvk_1:

Click to download the PDB-style file with coordinates for d1lvk_1.
(The format of our PDB-style files is described here.)

Timeline for d1lvk_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lvk_2