Lineage for d1dflb1 (1dfl B:29-76)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109314Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 109530Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 109531Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 109532Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)
  7. 109533Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (3 PDB entries)
  8. 109537Domain d1dflb1: 1dfl B:29-76 [24575]
    Other proteins in same PDB: d1dfla2, d1dflb2, d1dflw_, d1dflx_, d1dfly_, d1dflz_

Details for d1dflb1

PDB Entry: 1dfl (more details), 4.2 Å

PDB Description: scallop myosin s1 complexed with mgadp:vanadate-transition state

SCOP Domain Sequences for d1dflb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dflb1 b.34.3.1 (B:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians)}
dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs

SCOP Domain Coordinates for d1dflb1:

Click to download the PDB-style file with coordinates for d1dflb1.
(The format of our PDB-style files is described here.)

Timeline for d1dflb1: