![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) ![]() |
![]() | Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
![]() | Protein Myosin S1 fragment, N-terminal domain [50086] (4 species) |
![]() | Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (11 PDB entries) Uniprot P24733 3-836 ! Uniprot P24733 6-837 |
![]() | Domain d1dflb1: 1dfl B:29-76 [24575] Other proteins in same PDB: d1dfla2, d1dflb2, d1dflw_, d1dflx_, d1dfly_, d1dflz_ complexed with adp, ca, mg, vo4 |
PDB Entry: 1dfl (more details), 4.2 Å
SCOPe Domain Sequences for d1dflb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dflb1 b.34.3.1 (B:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs
Timeline for d1dflb1: