![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (16 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
![]() | Domain d3e1f14: 3e1f 1:626-730 [245749] Other proteins in same PDB: d3e1f11, d3e1f13, d3e1f15, d3e1f21, d3e1f23, d3e1f25, d3e1f31, d3e1f33, d3e1f35, d3e1f41, d3e1f43, d3e1f45 automated match to d1jz8a2 complexed with dms, gal, mg, na |
PDB Entry: 3e1f (more details), 3 Å
SCOPe Domain Sequences for d3e1f14:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e1f14 b.1.4.0 (1:626-730) automated matches {Escherichia coli K-12 [TaxId: 83333]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d3e1f14:
![]() Domains from same chain: (mouse over for more information) d3e1f11, d3e1f12, d3e1f13, d3e1f15 |