Lineage for d3e04a_ (3e04 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010373Protein automated matches [190147] (7 species)
    not a true protein
  7. 2010386Species Human (Homo sapiens) [TaxId:9606] [255805] (2 PDB entries)
  8. 2010387Domain d3e04a_: 3e04 A: [245740]
    automated match to d1yfma_
    complexed with edo

Details for d3e04a_

PDB Entry: 3e04 (more details), 1.95 Å

PDB Description: crystal structure of human fumarate hydratase
PDB Compounds: (A:) Fumarate hydratase

SCOPe Domain Sequences for d3e04a_:

Sequence, based on SEQRES records: (download)

>d3e04a_ a.127.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sfrieydtfgelkvpndkyygaqtvrstmnfkiggvtermptpvikafgilkraaaevnq
dygldpkianaimkaadevaegklndhfplvvwqtgsgtqtnmnvnevisnraiemlgge
lgskipvhpndhvnksqssndtfptamhiaaaievhevllpglqklhdaldakskefaqi
ikigrthtqdavpltlgqefsgyvqqvkyamtrikaampriyelaaggtavgtglntrig
faekvaakvaaltglpfvtapnkfealaahdalvelsgamnttacslmkiandirflgsg
prsglgelilpenepgssimpgkvnptqceamtmvaaqvmgnhvavtvggsnghfelnvf
kpmmiknvlhsarllgdasvsftencvvgiqanterinklmneslmlvtalnphigydka
akiaktahkngstlketaielgyltaeqfdewvkpkdmlgp

Sequence, based on observed residues (ATOM records): (download)

>d3e04a_ a.127.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sfrieydtfgelkvpndkyygaqtvrstmnfkiggvtermptpvikafgilkraaaevnq
dygldpkianaimkaadevaegklndhfplvvwqtgsgtqtnmnvnevisnraiemlgge
lgskipvhpndhvnksqssndtfptamhiaaaievhevllpglqklhdaldakskefaqi
ikigrthtqdavpltlgqefsgyvqqvkyamtrikaampriyelaaggtavgtglntrig
faekvaakvaaltglpfvtapnkfealaahdalvelsgamnttacslmkiandirflgsg
prsglgelilpenepggkvnptqceamtmvaaqvmgnhvavtvggsnghfelnvfkpmmi
knvlhsarllgdasvsftencvvgiqanterinklmneslmlvtalnphigydkaakiak
tahkngstlketaielgyltaeqfdewvkpkdmlgp

SCOPe Domain Coordinates for d3e04a_:

Click to download the PDB-style file with coordinates for d3e04a_.
(The format of our PDB-style files is described here.)

Timeline for d3e04a_: