SCOPe 2.05: Domain d1dfla1: 1dfl A:29-76

Lineage for d1dfla1 (1dfl A:29-76)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families)
Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (11 PDB entries)
Uniprot P24733 3-836 ! Uniprot P24733 6-837
Domain d1dfla1: 1dfl A:29-76 [24574]
Other proteins in same PDB: d1dfla2, d1dflb2, d1dflw_, d1dflx_, d1dfly_, d1dflz_
complexed with adp, ca, mg, vo4

Details for d1dfla1

PDB Entry: 1dfl (more details), 4.2 Å

PDB Description: scallop myosin s1 complexed with mgadp:vanadate-transition state

PDB Compounds: (A:) myosin head

SCOPe Domain Sequences for d1dfla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfla1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs

SCOPe Domain Coordinates for d1dfla1:

Click to download the PDB-style file with coordinates for d1dfla1.
(The format of our PDB-style files is described here.)

Timeline for d1dfla1: