| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
| Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
| Protein automated matches [190075] (60 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries) |
| Domain d3dypc3: 3dyp C:334-625 [245731] Other proteins in same PDB: d3dypa1, d3dypa2, d3dypa4, d3dypa5, d3dypb1, d3dypb2, d3dypb4, d3dypb5, d3dypc1, d3dypc2, d3dypc4, d3dypc5, d3dypd1, d3dypd2, d3dypd4, d3dypd5 automated match to d1jz7a5 complexed with dms, mg, na |
PDB Entry: 3dyp (more details), 1.75 Å
SCOPe Domain Sequences for d3dypc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dypc3 c.1.8.0 (C:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeanietngmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d3dypc3:
View in 3DDomains from same chain: (mouse over for more information) d3dypc1, d3dypc2, d3dypc4, d3dypc5 |