| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
| Protein automated matches [254633] (16 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
| Domain d3dypa2: 3dyp A:220-333 [245720] Other proteins in same PDB: d3dypa1, d3dypa3, d3dypa5, d3dypb1, d3dypb3, d3dypb5, d3dypc1, d3dypc3, d3dypc5, d3dypd1, d3dypd3, d3dypd5 automated match to d1jz8a1 complexed with dms, mg, na |
PDB Entry: 3dyp (more details), 1.75 Å
SCOPe Domain Sequences for d3dypa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dypa2 b.1.4.0 (A:220-333) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d3dypa2:
View in 3DDomains from same chain: (mouse over for more information) d3dypa1, d3dypa3, d3dypa4, d3dypa5 |