Lineage for d1b7ta1 (1b7t A:29-76)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796467Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 796468Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 796469Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 796470Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (11 PDB entries)
    Uniprot P24733 3-836
    Uniprot P24733 6-837
    Uniprot P24733 3-836 ! Uniprot P24733 6-837
  8. 796473Domain d1b7ta1: 1b7t A:29-76 [24572]
    Other proteins in same PDB: d1b7ta4, d1b7ty_, d1b7tz_
    complexed with adp, ca, mg

Details for d1b7ta1

PDB Entry: 1b7t (more details), 2.5 Å

PDB Description: myosin digested by papain
PDB Compounds: (A:) myosin heavy chain

SCOP Domain Sequences for d1b7ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7ta1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs

SCOP Domain Coordinates for d1b7ta1:

Click to download the PDB-style file with coordinates for d1b7ta1.
(The format of our PDB-style files is described here.)

Timeline for d1b7ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b7ta4