Lineage for d1b7ta1 (1b7t A:29-76)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109314Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 109530Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 109531Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 109532Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)
  7. 109533Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (3 PDB entries)
  8. 109534Domain d1b7ta1: 1b7t A:29-76 [24572]
    Other proteins in same PDB: d1b7ta4, d1b7ty_, d1b7tz_

Details for d1b7ta1

PDB Entry: 1b7t (more details), 2.5 Å

PDB Description: myosin digested by papain

SCOP Domain Sequences for d1b7ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7ta1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians)}
dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs

SCOP Domain Coordinates for d1b7ta1:

Click to download the PDB-style file with coordinates for d1b7ta1.
(The format of our PDB-style files is described here.)

Timeline for d1b7ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b7ta4