Lineage for d1br4g1 (1br4 G:34-79)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58264Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 58450Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 58451Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 58452Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)
  7. 58458Species Chicken (Gallus gallus), pectoral muscle [TaxId:9031] [50087] (4 PDB entries)
  8. 58473Domain d1br4g1: 1br4 G:34-79 [24571]
    Other proteins in same PDB: d1br4a2, d1br4b_, d1br4c2, d1br4d_, d1br4e2, d1br4f_, d1br4g2, d1br4h_

Details for d1br4g1

PDB Entry: 1br4 (more details), 3.62 Å

PDB Description: smooth muscle myosin motor domain-essential light chain complex with mgadp.bef3 bound at the active site

SCOP Domain Sequences for d1br4g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1br4g1 b.34.3.1 (G:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle}
lvwvpsekhgfeaasikeekgdevtvelqengkkvtlskddiqkmn

SCOP Domain Coordinates for d1br4g1:

Click to download the PDB-style file with coordinates for d1br4g1.
(The format of our PDB-style files is described here.)

Timeline for d1br4g1: