Lineage for d3dyoa1 (3dyo A:13-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2384768Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries)
  8. 2384777Domain d3dyoa1: 3dyo A:13-219 [245699]
    Other proteins in same PDB: d3dyoa2, d3dyoa3, d3dyoa4, d3dyoa5, d3dyob2, d3dyob3, d3dyob4, d3dyob5, d3dyoc2, d3dyoc3, d3dyoc4, d3dyoc5, d3dyod2, d3dyod3, d3dyod4, d3dyod5
    automated match to d1f49a3
    complexed with dms, ipt, mg, na

Details for d3dyoa1

PDB Entry: 3dyo (more details), 1.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (h418n) in complex with iptg
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3dyoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dyoa1 b.18.1.0 (A:13-219) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3dyoa1:

Click to download the PDB-style file with coordinates for d3dyoa1.
(The format of our PDB-style files is described here.)

Timeline for d3dyoa1: