Lineage for d3dymd3 (3dym D:334-625)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441237Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries)
  8. 2441285Domain d3dymd3: 3dym D:334-625 [245696]
    Other proteins in same PDB: d3dyma1, d3dyma2, d3dyma4, d3dyma5, d3dymb1, d3dymb2, d3dymb4, d3dymb5, d3dymc1, d3dymc2, d3dymc4, d3dymc5, d3dymd1, d3dymd2, d3dymd4, d3dymd5
    automated match to d1jz7a5
    complexed with dms, mg, na

Details for d3dymd3

PDB Entry: 3dym (more details), 2.05 Å

PDB Description: e. coli (lacz) beta-galactosidase (h418e)
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d3dymd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dymd3 c.1.8.0 (D:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeanietegmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d3dymd3:

Click to download the PDB-style file with coordinates for d3dymd3.
(The format of our PDB-style files is described here.)

Timeline for d3dymd3: