![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
![]() | Protein automated matches [190075] (125 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries) |
![]() | Domain d3dymd3: 3dym D:334-625 [245696] Other proteins in same PDB: d3dyma1, d3dyma2, d3dyma4, d3dyma5, d3dymb1, d3dymb2, d3dymb4, d3dymb5, d3dymc1, d3dymc2, d3dymc4, d3dymc5, d3dymd1, d3dymd2, d3dymd4, d3dymd5 automated match to d1jz7a5 complexed with dms, mg, na |
PDB Entry: 3dym (more details), 2.05 Å
SCOPe Domain Sequences for d3dymd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dymd3 c.1.8.0 (D:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeanietegmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d3dymd3:
![]() Domains from same chain: (mouse over for more information) d3dymd1, d3dymd2, d3dymd4, d3dymd5 |