![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (16 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
![]() | Domain d3dymb2: 3dym B:220-333 [245685] Other proteins in same PDB: d3dyma1, d3dyma3, d3dyma5, d3dymb1, d3dymb3, d3dymb5, d3dymc1, d3dymc3, d3dymc5, d3dymd1, d3dymd3, d3dymd5 automated match to d1jz8a1 complexed with dms, mg, na |
PDB Entry: 3dym (more details), 2.05 Å
SCOPe Domain Sequences for d3dymb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dymb2 b.1.4.0 (B:220-333) automated matches {Escherichia coli K-12 [TaxId: 83333]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d3dymb2:
![]() Domains from same chain: (mouse over for more information) d3dymb1, d3dymb3, d3dymb4, d3dymb5 |