Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (16 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
Domain d3dyma4: 3dym A:626-730 [245682] Other proteins in same PDB: d3dyma1, d3dyma3, d3dyma5, d3dymb1, d3dymb3, d3dymb5, d3dymc1, d3dymc3, d3dymc5, d3dymd1, d3dymd3, d3dymd5 automated match to d1jz8a2 complexed with dms, mg, na |
PDB Entry: 3dym (more details), 2.05 Å
SCOPe Domain Sequences for d3dyma4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dyma4 b.1.4.0 (A:626-730) automated matches {Escherichia coli K-12 [TaxId: 83333]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d3dyma4:
View in 3D Domains from same chain: (mouse over for more information) d3dyma1, d3dyma2, d3dyma3, d3dyma5 |