Lineage for d1br4a1 (1br4 A:34-79)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 295568Fold b.34: SH3-like barrel [50036] (13 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 295836Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 295837Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 295838Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)
  7. 295849Species Chicken (Gallus gallus), pectoral muscle [TaxId:9031] [50087] (4 PDB entries)
  8. 295861Domain d1br4a1: 1br4 A:34-79 [24568]
    Other proteins in same PDB: d1br4a2, d1br4b_, d1br4c2, d1br4d_, d1br4e2, d1br4f_, d1br4g2, d1br4h_

Details for d1br4a1

PDB Entry: 1br4 (more details), 3.62 Å

PDB Description: smooth muscle myosin motor domain-essential light chain complex with mgadp.bef3 bound at the active site

SCOP Domain Sequences for d1br4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1br4a1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle}
lvwvpsekhgfeaasikeekgdevtvelqengkkvtlskddiqkmn

SCOP Domain Coordinates for d1br4a1:

Click to download the PDB-style file with coordinates for d1br4a1.
(The format of our PDB-style files is described here.)

Timeline for d1br4a1: