Lineage for d3dyfb_ (3dyf B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (36 species)
    not a true protein
  7. 2011083Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [230726] (15 PDB entries)
  8. 2011098Domain d3dyfb_: 3dyf B: [245674]
    automated match to d2ewga_
    complexed with act, bme, ipr, mg, mpd, ni9

Details for d3dyfb_

PDB Entry: 3dyf (more details), 2.65 Å

PDB Description: T. Brucei Farnesyl Diphosphate Synthase Complexed with Bisphosphonate BPH-461 and Isopentyl Diphosphate
PDB Compounds: (B:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d3dyfb_:

Sequence, based on SEQRES records: (download)

>d3dyfb_ a.128.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
llslspnnngeeddgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyr
hpdvtvqcaindglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmf
dsnkldpdvsqptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvt
eelamlmgeyfqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefka
nygsgdsekvatvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwg
ktykrqk

Sequence, based on observed residues (ATOM records): (download)

>d3dyfb_ a.128.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
llsldgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyrhpdvtvqca
indglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmfdsnkldpdv
sqptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvteelamlmge
yfqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefkanygsgdsek
vatvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwgktykrqk

SCOPe Domain Coordinates for d3dyfb_:

Click to download the PDB-style file with coordinates for d3dyfb_.
(The format of our PDB-style files is described here.)

Timeline for d3dyfb_: