SCOPe 2.05: Domain d3dtrh2: 3dtr H:36-250

Lineage for d3dtrh2 (3dtr H:36-250)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (83 PDB entries)
   Uniprot P11846

8. Domain d3dtrh2: 3dtr H:36-250 [245660]
   Other proteins in same PDB: d3dtrh1, d3dtrl_, d3dtrm_
   automated match to d2j8dh2
   complexed with bcl, bph, cdl, fe, lda, spn, u10; mutant

Details for d3dtrh2

PDB Entry: 3dtr, 3.1 Å

PDB Description: e(l212)q, l(l227)f double mutant structure of photosynthetic reaction center from rhodobacter sphaeroides

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d3dtrh2:

Sequence; same for both SEQRES and ATOM records:

>d3dtrh2 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

Timeline for d3dtrh2:

• d3dtrh2 first appeared in SCOPe 2.04
  
• d3dtrh2 appears in SCOPe 2.06
  
• d3dtrh2 appears in the current release, SCOPe 2.08