Lineage for d3doja2 (3doj A:163-288)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721989Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255801] (1 PDB entry)
  8. 2721990Domain d3doja2: 3doj A:163-288 [245654]
    Other proteins in same PDB: d3doja1, d3doja3
    automated match to d3pdua2
    complexed with cl

Details for d3doja2

PDB Entry: 3doj (more details), 2.1 Å

PDB Description: structure of glyoxylate reductase 1 from arabidopsis (atglyr1)
PDB Compounds: (A:) Dehydrogenase-like protein

SCOPe Domain Sequences for d3doja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3doja2 a.100.1.0 (A:163-288) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vgngakmklivnmimgsmmnafseglvladksglssdtlldildlgamtnpmfkgkgpsm
nkssyppafplkhqqkdmrlalalgdenavsmpvaaaaneafkkarslglgdldfsavie
avkfsr

SCOPe Domain Coordinates for d3doja2:

Click to download the PDB-style file with coordinates for d3doja2.
(The format of our PDB-style files is described here.)

Timeline for d3doja2: