![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
![]() | Protein automated matches [226851] (46 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255801] (1 PDB entry) |
![]() | Domain d3doja2: 3doj A:163-288 [245654] Other proteins in same PDB: d3doja1, d3doja3 automated match to d3pdua2 complexed with cl |
PDB Entry: 3doj (more details), 2.1 Å
SCOPe Domain Sequences for d3doja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3doja2 a.100.1.0 (A:163-288) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} vgngakmklivnmimgsmmnafseglvladksglssdtlldildlgamtnpmfkgkgpsm nkssyppafplkhqqkdmrlalalgdenavsmpvaaaaneafkkarslglgdldfsavie avkfsr
Timeline for d3doja2: