| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255800] (14 PDB entries) |
| Domain d3doja1: 3doj A:1-162 [245653] Other proteins in same PDB: d3doja2, d3doja3 automated match to d3pdua1 complexed with cl |
PDB Entry: 3doj (more details), 2.1 Å
SCOPe Domain Sequences for d3doja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3doja1 c.2.1.0 (A:1-162) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mevgflglgimgkamsmnllkngfkvtvwnrtlskcdelvehgasvcespaevikkckyt
iamlsdpcaalsvvfdkggvleqicegkgyidmstvdaetslkineaitgkggrfvegpv
sgskkpaedgqliilaagdkalfeesipafdvlgkrsfylgq
Timeline for d3doja1: