SCOPe 2.06: Domain d3do7b2: 3do7 B:227-329

Lineage for d3do7b2 (3do7 B:227-329)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (55 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186988] (10 PDB entries)

8. Domain d3do7b2: 3do7 B:227-329 [245652]
   Other proteins in same PDB: d3do7a1, d3do7b1
   automated match to d1a3qa1
   protein/DNA complex

Details for d3do7b2

PDB Entry: 3do7, 3.05 Å

PDB Description: X-ray structure of a NF-kB p52/RelB/DNA complex

PDB Compounds: (B:) Nuclear factor NF-kappa-B p100 subunit

SCOPe Domain Sequences for d3do7b2:

Sequence; same for both SEQRES and ATOM records:

>d3do7b2 b.1.18.0 (B:227-329) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlkisrmdktagsvrggdevyllcdkvqkddievrfyeddengwqafgdfsptdvhkqya
ivfrtppyhkmkierpvtvflqlkrkrggdvsdskqftyyplv

Timeline for d3do7b2:

• d3do7b2 first appeared in SCOPe 2.04
  
• d3do7b2 appears in SCOPe 2.05
  
• d3do7b2 appears in SCOPe 2.07
  
• d3do7b2 appears in the current release, SCOPe 2.08