Lineage for d3do7b2 (3do7 B:227-329)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1523789Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1524658Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1524659Protein automated matches [190226] (39 species)
    not a true protein
  7. 1524749Species Human (Homo sapiens) [TaxId:9606] [186988] (9 PDB entries)
  8. 1524763Domain d3do7b2: 3do7 B:227-329 [245652]
    Other proteins in same PDB: d3do7a1, d3do7b1
    automated match to d1a3qa1
    protein/DNA complex

Details for d3do7b2

PDB Entry: 3do7 (more details), 3.05 Å

PDB Description: X-ray structure of a NF-kB p52/RelB/DNA complex
PDB Compounds: (B:) Nuclear factor NF-kappa-B p100 subunit

SCOPe Domain Sequences for d3do7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3do7b2 b.1.18.0 (B:227-329) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlkisrmdktagsvrggdevyllcdkvqkddievrfyeddengwqafgdfsptdvhkqya
ivfrtppyhkmkierpvtvflqlkrkrggdvsdskqftyyplv

SCOPe Domain Coordinates for d3do7b2:

Click to download the PDB-style file with coordinates for d3do7b2.
(The format of our PDB-style files is described here.)

Timeline for d3do7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3do7b1