| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (39 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186988] (9 PDB entries) |
| Domain d3do7b2: 3do7 B:227-329 [245652] Other proteins in same PDB: d3do7a1, d3do7b1 automated match to d1a3qa1 protein/DNA complex |
PDB Entry: 3do7 (more details), 3.05 Å
SCOPe Domain Sequences for d3do7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3do7b2 b.1.18.0 (B:227-329) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlkisrmdktagsvrggdevyllcdkvqkddievrfyeddengwqafgdfsptdvhkqya
ivfrtppyhkmkierpvtvflqlkrkrggdvsdskqftyyplv
Timeline for d3do7b2: