Lineage for d3do7b1 (3do7 B:37-226)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1772172Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 1772406Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 1772479Protein automated matches [254629] (2 species)
    not a true protein
  7. 1772480Species Human (Homo sapiens) [TaxId:9606] [255799] (1 PDB entry)
  8. 1772481Domain d3do7b1: 3do7 B:37-226 [245651]
    Other proteins in same PDB: d3do7a2, d3do7b2
    automated match to d1a3qa2
    protein/DNA complex

Details for d3do7b1

PDB Entry: 3do7 (more details), 3.05 Å

PDB Description: X-ray structure of a NF-kB p52/RelB/DNA complex
PDB Compounds: (B:) Nuclear factor NF-kappa-B p100 subunit

SCOPe Domain Sequences for d3do7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3do7b1 b.2.5.3 (B:37-226) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpylviveqpkqrgfrfrygcegpshgglpgassekgrktyptvkicnyegpakievdlv
thsdpprahahslvgkqcselgicavsvgpkdmtaqfnnlgvlhvtkknmmgtmiqklqr
qrlrsrpqglteaeqreleqeakelkkvmdlsivrlrfsaflrdsdgsfslplkpvisqp
ihdskspgas

SCOPe Domain Coordinates for d3do7b1:

Click to download the PDB-style file with coordinates for d3do7b1.
(The format of our PDB-style files is described here.)

Timeline for d3do7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3do7b2