Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (72 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [226768] (5 PDB entries) |
Domain d3do7a2: 3do7 A:279-383 [245650] Other proteins in same PDB: d3do7a1, d3do7b1 automated match to d1ikna1 protein/DNA complex |
PDB Entry: 3do7 (more details), 3.05 Å
SCOPe Domain Sequences for d3do7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3do7a2 b.1.18.0 (A:279-383) automated matches {Mouse (Mus musculus) [TaxId: 10090]} selricrinkesgpctggeelyllcdkvqkedisvvfstaswegradfsqadvhrqiaiv fktppyedleisepvtvnvflqrltdgvcseplpftylprdhdsy
Timeline for d3do7a2: