Lineage for d3do7a2 (3do7 A:279-383)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376282Species Mouse (Mus musculus) [TaxId:10090] [226768] (5 PDB entries)
  8. 2376291Domain d3do7a2: 3do7 A:279-383 [245650]
    Other proteins in same PDB: d3do7a1, d3do7b1
    automated match to d1ikna1
    protein/DNA complex

Details for d3do7a2

PDB Entry: 3do7 (more details), 3.05 Å

PDB Description: X-ray structure of a NF-kB p52/RelB/DNA complex
PDB Compounds: (A:) Avian reticuloendotheliosis viral (V-rel) oncogene related B

SCOPe Domain Sequences for d3do7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3do7a2 b.1.18.0 (A:279-383) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
selricrinkesgpctggeelyllcdkvqkedisvvfstaswegradfsqadvhrqiaiv
fktppyedleisepvtvnvflqrltdgvcseplpftylprdhdsy

SCOPe Domain Coordinates for d3do7a2:

Click to download the PDB-style file with coordinates for d3do7a2.
(The format of our PDB-style files is described here.)

Timeline for d3do7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3do7a1