SCOPe 2.06: Domain d3do7a2: 3do7 A:279-383

Lineage for d3do7a2 (3do7 A:279-383)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (55 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226768] (5 PDB entries)

8. Domain d3do7a2: 3do7 A:279-383 [245650]
   Other proteins in same PDB: d3do7a1, d3do7b1
   automated match to d1ikna1
   protein/DNA complex

Details for d3do7a2

PDB Entry: 3do7, 3.05 Å

PDB Description: X-ray structure of a NF-kB p52/RelB/DNA complex

PDB Compounds: (A:) Avian reticuloendotheliosis viral (V-rel) oncogene related B

SCOPe Domain Sequences for d3do7a2:

Sequence; same for both SEQRES and ATOM records:

>d3do7a2 b.1.18.0 (A:279-383) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
selricrinkesgpctggeelyllcdkvqkedisvvfstaswegradfsqadvhrqiaiv
fktppyedleisepvtvnvflqrltdgvcseplpftylprdhdsy

Timeline for d3do7a2:

• d3do7a2 first appeared in SCOPe 2.04
  
• d3do7a2 appears in SCOPe 2.05
  
• d3do7a2 appears in SCOPe 2.07
  
• d3do7a2 appears in the current release, SCOPe 2.08