Lineage for d3do7a1 (3do7 A:88-278)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040931Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2041189Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2041262Protein automated matches [254629] (2 species)
    not a true protein
  7. 2041265Species Mouse (Mus musculus) [TaxId:10090] [255600] (2 PDB entries)
  8. 2041266Domain d3do7a1: 3do7 A:88-278 [245649]
    Other proteins in same PDB: d3do7a2, d3do7b2
    automated match to d1ikna2
    protein/DNA complex

Details for d3do7a1

PDB Entry: 3do7 (more details), 3.05 Å

PDB Description: X-ray structure of a NF-kB p52/RelB/DNA complex
PDB Compounds: (A:) Avian reticuloendotheliosis viral (V-rel) oncogene related B

SCOPe Domain Sequences for d3do7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3do7a1 b.2.5.3 (A:88-278) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sctlgrlvspgpcprpylviteqpkqrgmrfryecegrsagsilgessteasktqpaiel
rdcgglrevevtaclvwkdwphrvhphslvgkdctdgvcrvrlrphvsprhsfnnlgiqc
vrkkeieaaierkiqlgidpynagslknhqevdmnvvricfqasyrdqqghlhrmdpils
epvydkkstnt

SCOPe Domain Coordinates for d3do7a1:

Click to download the PDB-style file with coordinates for d3do7a1.
(The format of our PDB-style files is described here.)

Timeline for d3do7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3do7a2