SCOP 1.63: Domain d1br1a1: 1br1 A:34-79

Lineage for d1br1a1 (1br1 A:34-79)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.34: SH3-like barrel [50036] (12 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)

7. Species Chicken (Gallus gallus), pectoral muscle [TaxId:9031] [50087] (4 PDB entries)

8. Domain d1br1a1: 1br1 A:34-79 [24564]
   Other proteins in same PDB: d1br1a2, d1br1b_, d1br1c2, d1br1d_, d1br1e2, d1br1f_, d1br1g2, d1br1h_

Details for d1br1a1

PDB Entry: 1br1, 3.5 Å

PDB Description: smooth muscle myosin motor domain-essential light chain complex with mgadp.alf4 bound at the active site

SCOP Domain Sequences for d1br1a1:

Sequence; same for both SEQRES and ATOM records:

>d1br1a1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle}
lvwvpsekhgfeaasikeekgdevtvelqengkkvtlskddiqkmn

Timeline for d1br1a1:

• d1br1a1 first appeared (with stable ids) in SCOP 1.55
  
• d1br1a1 appears in SCOP 1.61
  
• d1br1a1 appears in SCOP 1.65
  
• d1br1a1 appears in the current release, SCOPe 2.08