SCOPe 2.08: Domain d3dh1c1: 3dh1 C:20-172

Lineage for d3dh1c1 (3dh1 C:20-172)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.0: automated matches [191471] (1 protein)
   not a true family

6. Protein automated matches [190746] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225587] (2 PDB entries)

8. Domain d3dh1c1: 3dh1 C:20-172 [245638]
   Other proteins in same PDB: d3dh1a2, d3dh1b2, d3dh1c2, d3dh1d2
   automated match to d2b3jc_
   complexed with zn

Details for d3dh1c1

PDB Entry: 3dh1, 2.8 Å

PDB Description: Crystal structure of human tRNA-specific adenosine-34 deaminase subunit ADAT2

PDB Compounds: (C:) tRNA-specific adenosine deaminase 2

SCOPe Domain Sequences for d3dh1c1:

Sequence; same for both SEQRES and ATOM records:

>d3dh1c1 c.97.1.0 (C:20-172) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eetekwmeeamhmakealentevpvgclmvynnevvgkgrnevnqtknatrhaemvaidq
vldwcrqsgkspsevfehtvlyvtvepcimcaaalrlmkiplvvygcqnerfggcgsvln
iasadlpntgrpfqcipgyraeeavemlktfyk

Timeline for d3dh1c1:

• d3dh1c1 first appeared in SCOPe 2.04, called d3dh1c_
  
• d3dh1c1 appears in SCOPe 2.07