Lineage for d3demb3 (3dem B:166-278)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777703Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777704Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 2777749Family b.23.1.0: automated matches [254288] (1 protein)
    not a true family
  6. 2777750Protein automated matches [254671] (1 species)
    not a true protein
  7. 2777751Species Human (Homo sapiens) [TaxId:9606] [255797] (4 PDB entries)
  8. 2777755Domain d3demb3: 3dem B:166-278 [245631]
    Other proteins in same PDB: d3dema2, d3demb2
    automated match to d1nt0a2
    complexed with ca, nag

Details for d3demb3

PDB Entry: 3dem (more details), 2.3 Å

PDB Description: cub1-egf-cub2 domain of human masp-1/3
PDB Compounds: (B:) Complement factor MASP-3

SCOPe Domain Sequences for d3demb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3demb3 b.23.1.0 (B:166-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
csdnlftqrtgvitspdfpnpypksseclytieleegfmvnlqfedifdiedhpevpcpy
dyikikvgpkvlgpfcgekapepistqshsvlilfhsdnsgenrgwrlsyraa

SCOPe Domain Coordinates for d3demb3:

Click to download the PDB-style file with coordinates for d3demb3.
(The format of our PDB-style files is described here.)

Timeline for d3demb3: