SCOP 1.67: Domain d1br2f1: 1br2 F:34-79

Lineage for d1br2f1 (1br2 F:34-79)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)

7. Species Chicken (Gallus gallus), pectoral muscle [TaxId:9031] [50087] (4 PDB entries)

8. Domain d1br2f1: 1br2 F:34-79 [24563]
   Other proteins in same PDB: d1br2a2, d1br2b2, d1br2c2, d1br2d2, d1br2e2, d1br2f2
   complexed with adp, alf, mg

Details for d1br2f1

PDB Entry: 1br2, 2.9 Å

PDB Description: smooth muscle myosin motor domain complexed with mgadp.alf4

SCOP Domain Sequences for d1br2f1:

Sequence, based on SEQRES records:

>d1br2f1 b.34.3.1 (F:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle}
lvwvpsekhgfeaasikeekgdevtvelqengkkvtlskddiqkmn

Sequence, based on observed residues (ATOM records):

>d1br2f1 b.34.3.1 (F:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle}
lvwvpsekhgfeaasievtvelqengkkvtlskddiqkmn

Timeline for d1br2f1:

• d1br2f1 first appeared (with stable ids) in SCOP 1.55
  
• d1br2f1 appears in SCOP 1.65
  
• d1br2f1 appears in SCOP 1.69
  
• d1br2f1 appears in the current release, SCOPe 2.08