![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.23: CUB-like [49853] (3 superfamilies) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) ![]() automatically mapped to Pfam PF00431 |
![]() | Family b.23.1.0: automated matches [254288] (1 protein) not a true family |
![]() | Protein automated matches [254671] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255797] (4 PDB entries) |
![]() | Domain d3dema1: 3dem A:7-120 [245626] Other proteins in same PDB: d3dema2, d3demb2 automated match to d1nt0a1 complexed with ca, nag |
PDB Entry: 3dem (more details), 2.3 Å
SCOPe Domain Sequences for d3dema1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dema1 b.23.1.0 (A:7-120) automated matches {Human (Homo sapiens) [TaxId: 9606]} nmfgqiqspgypdsypsdsevtwnitvpdgfriklyfmhfnlessylceydyvkvetedq vlatfcgrettdteqtpgqevvlspgsfmsitfrsdfsneerftgfdahymavd
Timeline for d3dema1: