Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries) |
Domain d3dbsa1: 3dbs A:144-321 [245620] Other proteins in same PDB: d3dbsa2, d3dbsa3, d3dbsa4, d3dbsa5 automated match to d1e7ua3 complexed with gd9 |
PDB Entry: 3dbs (more details), 2.8 Å
SCOPe Domain Sequences for d3dbsa1:
Sequence, based on SEQRES records: (download)
>d3dbsa1 d.15.1.0 (A:144-321) automated matches {Human (Homo sapiens) [TaxId: 9606]} seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipe sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke
>d3dbsa1 d.15.1.0 (A:144-321) automated matches {Human (Homo sapiens) [TaxId: 9606]} seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmaeqdfvlrvcg rdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke
Timeline for d3dbsa1:
View in 3D Domains from same chain: (mouse over for more information) d3dbsa2, d3dbsa3, d3dbsa4, d3dbsa5 |