SCOPe 2.08: Domain d3dbib_: 3dbi B:

Lineage for d3dbib_ (3dbi B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (77 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225166] (3 PDB entries)

8. Domain d3dbib_: 3dbi B: [245617]
   automated match to d3brqb_
   protein/DNA complex; complexed with gol, po4

Details for d3dbib_

PDB Entry: 3dbi, 2.45 Å

PDB Description: crystal structure of sugar-binding transcriptional regulator (laci family) from escherichia coli complexed with phosphate

PDB Compounds: (B:) Sugar-binding transcriptional regulator, LacI family

SCOPe Domain Sequences for d3dbib_:

Sequence; same for both SEQRES and ATOM records:

>d3dbib_ c.93.1.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kstqtlglvvtntlyhgiyfsellfhaarmaeekgrqllladgkhsaeeerqaiqylldl
rcdaimiyprflsvdeiddiidahsqpimvlnrrlrknsshsvwcdhkqtsfnavaelin
aghqeiafltgsmdsptsierlagykdalaqhgialnekliangkwtpasgaegvemlle
rgakfsalvasnddmaigamkalhergvavpeqvsvigfddiaiapytvpalssvkipvt
emiqeiigrlifmldggdfsppktfsgklirrdsliap

Timeline for d3dbib_:

• d3dbib_ first appeared in SCOPe 2.04
  
• d3dbib_ appears in SCOPe 2.07