Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (35 species) not a true protein |
Species Zebrafish (Danio rerio) [TaxId:7955] [225503] (8 PDB entries) |
Domain d3dbda_: 3dbd A: [245615] automated match to d4j7ba_ complexed with 3fr |
PDB Entry: 3dbd (more details), 3.05 Å
SCOPe Domain Sequences for d3dbda_:
Sequence, based on SEQRES records: (download)
>d3dbda_ d.144.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} keipdvlvdprtmkrymrgrflgkggfakcyeitdmdtkevfagkvvpksmllkphqkek msteiaihksldnphvvgfhgffedddfvyvvleicrrrsllelhkrrkavtepearyfm rqtiqgvqylhnnrvihrdlklgnlflnddmdvkigdfglatkiefdgerkkdlcgtpny iapevlckkghsfevdiwslgcilytllvgkppfetsclketyirikkneysvprhinpv asalirrmlhadptlrpsvaelltdefftsgyapmrlptscltvppr
>d3dbda_ d.144.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} keipdvlvdprtmkrymrgrflgkggfakcyeitdmdtkevfagkvvpksmllkphqkek msteiaihksldnphvvgfhgffedddfvyvvleicrrrsllelhkrrkavtepearyfm rqtiqgvqylhnnrvihrdlklgnlflnddmdvkigdfglatkihsfevdiwslgcilyt llvgkppfetsclketyirikkneysvprhinpvasalirrmlhadptlrpsvaelltde fftsgyapmrlptscltvppr
Timeline for d3dbda_: