Lineage for d3d8tb1 (3d8t B:1-248)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921117Fold c.113: HemD-like [69617] (1 superfamily)
    duplication: consists of two similar 'swapped' domain with 3 layers (a/b/a) each; parallel beta-sheet of 5 strands, order 21345
  4. 2921118Superfamily c.113.1: HemD-like [69618] (1 family) (S)
    automatically mapped to Pfam PF02602
  5. 2921119Family c.113.1.1: HemD-like [69619] (3 proteins)
    Pfam PF02602
  6. 2921128Protein automated matches [190804] (2 species)
    not a true protein
  7. 2921129Species Thermus thermophilus [TaxId:262724] [255795] (4 PDB entries)
  8. 2921131Domain d3d8tb1: 3d8t B:1-248 [245612]
    Other proteins in same PDB: d3d8ta2, d3d8tb2
    automated match to d1wd7a_
    complexed with act

Details for d3d8tb1

PDB Entry: 3d8t (more details), 1.6 Å

PDB Description: Thermus thermophilus Uroporphyrinogen III Synthase
PDB Compounds: (B:) uroporphyrinogen-III synthase

SCOPe Domain Sequences for d3d8tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d8tb1 c.113.1.1 (B:1-248) automated matches {Thermus thermophilus [TaxId: 262724]}
mriayaglrrkeefkalaeklgftpllfpvqatekvpvpeyrdqvrelaqgvdlflattg
vgvrdlleagkalgldlegplakafrlargakaaralkeaglpphavgdgtsksllpllp
qgrgvaalqlygkplpllenalaergyrvlplmpyrhlpdpegilrleeavlrgevdala
fvaaiqveflfegakdpkalrealntrvkalavgrvtadalrewgvkpfyvdeterlgsl
lqgfkral

SCOPe Domain Coordinates for d3d8tb1:

Click to download the PDB-style file with coordinates for d3d8tb1.
(The format of our PDB-style files is described here.)

Timeline for d3d8tb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3d8tb2