![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.113: HemD-like [69617] (1 superfamily) duplication: consists of two similar 'swapped' domain with 3 layers (a/b/a) each; parallel beta-sheet of 5 strands, order 21345 |
![]() | Superfamily c.113.1: HemD-like [69618] (1 family) ![]() automatically mapped to Pfam PF02602 |
![]() | Family c.113.1.1: HemD-like [69619] (3 proteins) Pfam PF02602 |
![]() | Protein automated matches [190804] (2 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:262724] [255795] (4 PDB entries) |
![]() | Domain d3d8tb1: 3d8t B:1-248 [245612] Other proteins in same PDB: d3d8ta2, d3d8tb2 automated match to d1wd7a_ complexed with act |
PDB Entry: 3d8t (more details), 1.6 Å
SCOPe Domain Sequences for d3d8tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d8tb1 c.113.1.1 (B:1-248) automated matches {Thermus thermophilus [TaxId: 262724]} mriayaglrrkeefkalaeklgftpllfpvqatekvpvpeyrdqvrelaqgvdlflattg vgvrdlleagkalgldlegplakafrlargakaaralkeaglpphavgdgtsksllpllp qgrgvaalqlygkplpllenalaergyrvlplmpyrhlpdpegilrleeavlrgevdala fvaaiqveflfegakdpkalrealntrvkalavgrvtadalrewgvkpfyvdeterlgsl lqgfkral
Timeline for d3d8tb1: