SCOPe 2.08: Domain d3d8ta1: 3d8t A:1-251

Lineage for d3d8ta1 (3d8t A:1-251)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.113: HemD-like [69617] (1 superfamily)
   duplication: consists of two similar 'swapped' domain with 3 layers (a/b/a) each; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.113.1: HemD-like [69618] (1 family)
   automatically mapped to Pfam PF02602

5. Family c.113.1.1: HemD-like [69619] (3 proteins)
   Pfam PF02602

6. Protein automated matches [190804] (2 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:262724] [255795] (4 PDB entries)

8. Domain d3d8ta1: 3d8t A:1-251 [245611]
   Other proteins in same PDB: d3d8ta2, d3d8tb2
   automated match to d1wd7a_
   complexed with act

Details for d3d8ta1

PDB Entry: 3d8t, 1.6 Å

PDB Description: Thermus thermophilus Uroporphyrinogen III Synthase

PDB Compounds: (A:) uroporphyrinogen-III synthase

SCOPe Domain Sequences for d3d8ta1:

Sequence; same for both SEQRES and ATOM records:

>d3d8ta1 c.113.1.1 (A:1-251) automated matches {Thermus thermophilus [TaxId: 262724]}
mriayaglrrkeefkalaeklgftpllfpvqatekvpvpeyrdqvrelaqgvdlflattg
vgvrdlleagkalgldlegplakafrlargakaaralkeaglpphavgdgtsksllpllp
qgrgvaalqlygkplpllenalaergyrvlplmpyrhlpdpegilrleeavlrgevdala
fvaaiqveflfegakdpkalrealntrvkalavgrvtadalrewgvkpfyvdeterlgsl
lqgfkralqke

Timeline for d3d8ta1:

• d3d8ta1 first appeared in SCOPe 2.04, called d3d8ta_
  
• d3d8ta1 appears in SCOPe 2.07