SCOPe 2.08: Domain d3d12e_: 3d12 E:

Lineage for d3d12e_ (3d12 E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255792] (1 PDB entry)

8. Domain d3d12e_: 3d12 E: [245602]
   automated match to d1ikop_
   complexed with nag, so4

Details for d3d12e_

PDB Entry: 3d12, 3.01 Å

PDB Description: crystal structures of nipah virus g attachment glycoprotein in complex with its receptor ephrin-b3

PDB Compounds: (E:) Ephrin-B3

SCOPe Domain Sequences for d3d12e_:

Sequence; same for both SEQRES and ATOM records:

>d3d12e_ b.6.1.0 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
slepvywnsankrfqaeggyvlypqigdrldllcprarppgphsspsyefyklylvegaq
grrceappapnllltcdrpdldlrftikfqeyspnlwghefrshhdyyiiatsdgtregl
eslqggvcltrgmkvllrvgq

Timeline for d3d12e_:

• d3d12e_ first appeared in SCOPe 2.04
  
• d3d12e_ appears in SCOPe 2.07