Lineage for d3d12e_ (3d12 E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367979Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2367980Protein automated matches [190824] (23 species)
    not a true protein
  7. 2368223Species Mouse (Mus musculus) [TaxId:10090] [255792] (1 PDB entry)
  8. 2368225Domain d3d12e_: 3d12 E: [245602]
    automated match to d1ikop_
    complexed with bgc, bma, gl0, glc, gxl, lxb, lxz, man, nag, nga, ngz, so4

Details for d3d12e_

PDB Entry: 3d12 (more details), 3.01 Å

PDB Description: crystal structures of nipah virus g attachment glycoprotein in complex with its receptor ephrin-b3
PDB Compounds: (E:) Ephrin-B3

SCOPe Domain Sequences for d3d12e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d12e_ b.6.1.0 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
slepvywnsankrfqaeggyvlypqigdrldllcprarppgphsspsyefyklylvegaq
grrceappapnllltcdrpdldlrftikfqeyspnlwghefrshhdyyiiatsdgtregl
eslqggvcltrgmkvllrvgq

SCOPe Domain Coordinates for d3d12e_:

Click to download the PDB-style file with coordinates for d3d12e_.
(The format of our PDB-style files is described here.)

Timeline for d3d12e_: