![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
![]() | Protein automated matches [190824] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [255792] (1 PDB entry) |
![]() | Domain d3d12e_: 3d12 E: [245602] automated match to d1ikop_ complexed with nag, so4 |
PDB Entry: 3d12 (more details), 3.01 Å
SCOPe Domain Sequences for d3d12e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d12e_ b.6.1.0 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} slepvywnsankrfqaeggyvlypqigdrldllcprarppgphsspsyefyklylvegaq grrceappapnllltcdrpdldlrftikfqeyspnlwghefrshhdyyiiatsdgtregl eslqggvcltrgmkvllrvgq
Timeline for d3d12e_: