Lineage for d3d0he_ (3d0h E:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1689021Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
    core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542
  4. 1689022Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) (S)
    automatically mapped to Pfam PF09408
  5. 1689023Family d.318.1.1: SARS receptor-binding domain-like [143588] (2 proteins)
    part of PfamB PB000266
  6. 1689024Protein Spike protein S1 [143589] (1 species)
  7. 1689025Species SARS coronavirus [TaxId:227859] [143590] (8 PDB entries)
    Uniprot P59594 320-502! Uniprot P59594 321-512! Uniprot P59594 323-502
  8. 1689039Domain d3d0he_: 3d0h E: [245599]
    Other proteins in same PDB: d3d0ha_, d3d0hb_
    automated match to d2ghwa_
    complexed with cl, nag, ndg, zn

Details for d3d0he_

PDB Entry: 3d0h (more details), 3.1 Å

PDB Description: crystal structure of spike protein receptor-binding domain from the 2002-2003 sars coronavirus civet strain complexed with human-civet chimeric receptor ace2
PDB Compounds: (E:) Spike protein S1

SCOPe Domain Sequences for d3d0he_:

Sequence, based on SEQRES records: (download)

>d3d0he_ d.318.1.1 (E:) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
pfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfsnvy
adsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyryl
rhgklrpferdisnvpfspdgkpctppalncywplkdygfyttsgigyqpyrvvvlsfe

Sequence, based on observed residues (ATOM records): (download)

>d3d0he_ d.318.1.1 (E:) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
pfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklnvyadsfvv
kgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyrylrhgklr
pferdisnvpfspdgkpctppalncywplkdygfyttsgigyqpyrvvvlsfe

SCOPe Domain Coordinates for d3d0he_:

Click to download the PDB-style file with coordinates for d3d0he_.
(The format of our PDB-style files is described here.)

Timeline for d3d0he_: