Lineage for d3czjc3 (3czj C:334-625)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441237Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries)
  8. 2441280Domain d3czjc3: 3czj C:334-625 [245589]
    Other proteins in same PDB: d3czja1, d3czja2, d3czja4, d3czja5, d3czjb1, d3czjb2, d3czjb4, d3czjb5, d3czjc1, d3czjc2, d3czjc4, d3czjc5, d3czjd1, d3czjd2, d3czjd4, d3czjd5
    automated match to d1jz7a5
    complexed with 149, dms, mg, na

Details for d3czjc3

PDB Entry: 3czj (more details), 2.05 Å

PDB Description: e. coli (lacz) beta-galactosidase (n460t) in complex with d- galctopyranosyl-1-one
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3czjc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3czjc3 c.1.8.0 (C:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgtesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d3czjc3:

Click to download the PDB-style file with coordinates for d3czjc3.
(The format of our PDB-style files is described here.)

Timeline for d3czjc3: